<!-- --><!-- --><style type="text/css">@import url(http://www.blogger.com/css/navbar/classic.css); div.b-mobile {display:none;} </style> <!-- --><style type="text/css">@import url(http://www.blogger.com/css/navbar/classic.css); div.b-mobile {display:none;} </style> <meta name='google-adsense-platform-account' content='ca-host-pub-1556223355139109'/> <meta name='google-adsense-platform-domain' content='blogspot.com'/> <!-- --><style type="text/css">@import url(https://www.blogger.com/static/v1/v-css/navbar/3334278262-classic.css); div.b-mobile {display:none;} </style> </head><body><script type="text/javascript"> function setAttributeOnload(object, attribute, val) { if(window.addEventListener) { window.addEventListener('load', function(){ object[attribute] = val; }, false); } else { window.attachEvent('onload', function(){ object[attribute] = val; }); } } </script> <div id="navbar-iframe-container"></div> <script type="text/javascript" src="https://apis.google.com/js/platform.js"></script> <script type="text/javascript"> gapi.load("gapi.iframes:gapi.iframes.style.bubble", function() { if (gapi.iframes && gapi.iframes.getContext) { gapi.iframes.getContext().openChild({ url: 'https://www.blogger.com/navbar/35634219?origin\x3dhttp://st-acytan.blogspot.com', where: document.getElementById("navbar-iframe-container"), id: "navbar-iframe" }); } }); </script> <iframe src="http://www.blogger.com/navbar.g?targetBlogID=2432823265374446606&blogName=Blendednotes&publishMode=PUBLISH_MODE_BLOGSPOT&navbarType=BLUE&layoutType=CLASSIC&homepageUrl=http%3A%2F%2Fblendednotes.blogspot.com%2F&searchRoot=http%3A%2F%2Fblendednotes.blogspot.com%2Fsearch" height="30px" width="100%" marginwidth="0" marginheight="0" scrolling="no" id="navbar-iframe" frameborder="0"></iframe> <div id="space-for-ie"></div> <iframe src="http://www.blogger.com/navbar.g?targetBlogID=3912990342876537107&blogName=Everyday%2C&publishMode=PUBLISH_MODE_BLOGSPOT&navbarType=BLUE&layoutType=CLASSIC&homepageUrl=http%3A%2F%2Fbeautifullyengraved.blogspot.com%2F&searchRoot=http%3A%2F%2Fbeautifullyengraved.blogspot.com%2Fsearch" height="30px" width="100%" marginwidth="0" marginheight="0" scrolling="no" id="navbar-iframe" frameborder="0"></iframe> <div id="space-for-ie"></div> kohzhihao; tanqianyi ♥
25.12.06 '



deck the halls with chocs and ice-creams! falalalala lalalala! i hear jingle bells!

12.10am. it's officially christmas! ahhas. yayness. presents and all. (: so i called edwin and he was so disappointed when i asked him to try it out with geraldine. whenever i asked him to accept smoeone else, he answers, 'i only want you and that's all.' omg. touched but sorry edwin. it will never be possible between us. i regard you as my bro and that's it. my darling bro. ((: <3 you.

so i bought presents for everyone on my besties list. since i have nothing to do then lets go over the list.

*in alphabetical order
[those bolded means that they are special to me]
[those unbolded means that they are important to me as well]
Amanda
Alexa
Angelin
Adeline
Ai Ting
Brandon
Cassandra
Daryl
Edwin
Elson
Evelyn
Genevie
Germaine
Hui Qin
Hui Ting
Jing Qi
Jocelyn
Jessica
Josephine
Leanette
Leon
Mandy
Mike
Nicole
Nelson
Sherlin
Shawn
Shuandy
Shadow
Wen Lin

ok. so there you go. i think i will be so broke. ahhas. wait. i AM broke. whatever. merry christmas. (:

my evil side


24.12.06 '



went to orchard with manda and gene. omg. manda wore a tank-top with an extra short shorts and gene was wearing back-revealing top with a mini-skirt. ahhas. so sexy luhs. so we were laughing loudly and manda was like swaying in the mrt. i effing swear that people were looking at us. psycho can. (:

took some crazy neos and gene was looking at cute guys. did some last minute christmas shopping and we shopped till we were broke and manda wanted to try out loads of tees. so gene and i waited till we almost tore down the fitting room door. ahhas. gene called philip to come find her and so manda and i were like whatever luhs. ahhas. cause gene had to see philip for like 5 or 6 times a day. omg. so loving. ((: we saw mei yi and her friends so we said hello and chatted for awhile. haven't seen her for a long time since she transferred. then manda told me something shocking. SOMEONE LIKES EDWIN! and that someone is geraldine from another class. omg. ahhas. it is shocking as edwin didn't tell me about it. manda said that he knows but didn't want to tell me as he is afraid that i will encourage him to accept her. weird. geraldine is a nice girl and so of course i will encourage edwin to go for it. am going to call him later.

daryl brought skittles over and loads of it. and so we ate and ate and ate till it was all gone in 15minutes. ahhas. great eater. (: and i stuffed all green ones in daryl's mouth. i am so evil. x : blog more later.

my evil side


'



have not been updating recently. ahhas. sorry guys. almost no mood to do it. there's one thing to be happy though. LAV IS COMING BACK! omg! her flight is scheduled to be landing on 14apr, 1:05pm. ahhas. yayness. am going to fetch her with everyone else. (: but although it is still quite far away.

am going out with manda and gene later on. oh well. update more later. (((:

my evil side


20.12.06 '



UPDATES ARE ON SOON MY PEEPS! (:

my evil side


12.12.06 '



it's like 8am now. was bitching with manda about stuffs. manda saw the new fendi bag and wanted to buy it so she decided to use her own money. ahhas. manda, it cost like heaps. focus more on studies. (: manda and i made a friendship pact that we will never ever leave each other alone. if whoever back out first then she will have pimpleS. ahhas. evil. (:<

daryl bought me some chocs and ice tea. omg. i am like desperately trying to lose weight and yet here he is buying all sorts of snacks for me. he reasons that it is to fatten me up so that no one will notice me. ahhas. lame luhs. am going out with manda and gene. blog later. <3.

my evil side


8.12.06 '



ahhas. yes, i have just locked my blog and so only my peeps can view it. (: how evil am i. well don't blame me as someone send me a gross email. i shall not disclose what i contains this time but hey. i have my own privacy. whatever. my throat is freaking sore and daryl is cooking something for me. ahhas. i have no idea what it is but it should be something bitter. ):

it's funny how thing works. if i put a face like this, ): without the eyebrow, it looks so sad right. ahhas. and well, if i put the brows, ):< it looks so angry. ahhas. psycho luhs. whatever and and byebyebye. <3.

my evil side


'



am listening to a crappy song now and im-ing manda. ahhas. my voice is so sore and when i sing. oh shit. i so hate sher. ):< daryl is coming over later to accompany me and i asked him to bring some chocs over. he scolded me. ahhhs. fine. i won't eat any chocs for the next 2 days. (: and then it's heaps and heaps of chocs after that. ahhas. how psycho right.

my eyes are quite painful especially my right eye. argh. sfghkipwnifnshfjakfsk! what the hell is exactly happening to me? i can't feel myself and boy. i feel so sick. ): bye. *without my love* and anyway i deleted my taggy. ((:

my evil side


'



frigging shit. i am having a cold and it's all thanks to sher. ):< I CAN'T ENJOY MY CHOCS! fcuk you sher. argh argh argh! )):< double frowns.

went off to eat dinner at jack's place and sher ordered grilled chicken and when she couldn't finish it, she shoved it all on to my plate and my mum forced me to finish everything. argh. and now it caused me my sore throat plus my darn cold. i am so gonna frown at sher today. ))::<< I WANNA GO OUT!

why isn't anyone online at this time? i mean, it's 5am, a perfect time for people to come online and chat! i am so frigging bored and i am so gonna get my panda eyes soon. hooray! ((: *madness* ahhas. argh shit. i am hungry now. i want my chocs but my mum kept all of it away from me. frowns frowns frowns frowns more! ):< ):< ):< ):< i need my chocs for my energy or else i will sleep early tomorrow night! x :

ARGH! something happened and i am so fcuking pissed off. that stupid weighing machine. when i stepped on it, it showed me something scary. 47kg! argh. i effing swear that i immediately smashed the weighing machine with my com chair. shit luhs. that's it. diet time again and again. i am gonna run 5rounds round the park and no one is gonna stop me. no more chocs for the next 2days. ):<

ok, so how many frowns have i got here? ahhas. count it yourself dimwit. and and my argh is so plentiful in this post. i am feeling so sad and pissed off now. someone save me! (: byebyebye. <3s. sleep is essential.

my evil side


7.12.06 '



so like i am eating the skittles that mike bought for me and i so hate the green ones. eww. kiwi lime. x : ahhas. i grabbed this from manda's blog. (:

had sex-- $20

smoked-- $12
got drunk-- $21
went skinny dipping-- $10
kissed someone of the opposite sex-- $1
had more than one bf/gf at the sametime--$3
cheated-- $2
fell asleep in class-- $0.50
cheated on a quiz-- $5
been expelled-- $1
been in a fist fight-- $2
done oral-- $18
got oral-- $10
prank called the cops-- $1
stole something-- $10
done drugs-- $12
dyed your hair-- $10
done something with someone older-- $2
went out with someone OVER 18 if you're under 18--$3
ate a whole thing of oreos-- $1
cried yourself to sleep-- $5
said you love someone but didnt mean it--$2
been in love-- $2
got caught doing something that you shouldnt have been doing-- $7
went streaking-- $10
got arrested-- $1
madeout with someone at the movies-- $6
peed in the pool-- $10
played spin the bottle-- $5
done something you regret-- $5
had sex with more than one person-- $9
been to NYC drunk or stoned-- $8
owned your own car-- $10
had a job for more than 2 months-- $20

ahhas. my total was $71.50. wth. i am such an angel. more coming up. ((:

my evil side


'



i am so addicted to this song. Wind it up by Gwen Stefani. ahhas. manda threw this song into my head yesterday and now i am addicted to it. whatever. just came back from shopping with mandy and yes. i know it's still early. mandy was kind of pressed for time as she needed to reach home by 5pm to look after her baby sister. ahhas. good sister luhs. something happened earlier on and well, it affected our moods. will elaborate more later.

wanted to head over to pr to find daryl but mandy said, 'hey, are you mad? from one end of singapore to the other?' ahhas. and so i went home. was quite sleepy anyway due to the 5hour sleep. wth. saw auntie nathlia at my house with adeline and aunt nathlia's sister, i call her auntie nadine. when she saw me, her first reaction was, 'wow! what happened to your hair girl? why go dye your hair? not studying?' ahhas. i swear, i almost laughed but i kept quiet and smiled. why did i want to laugh? ahhas. because she was at adeline's birthday party last night too and yet it was till now then she asked me about my hair. i mean, wth right. oh well.

sher said daryl called me twice and asked me to call him back. will probably call him later. ohman. i just ate 5 packets of kinder bueno and am so bloated now. ahhas. i am so gonna gain 2kg. (: so like lexa and i chatted in msn and she mentioned about someone named, celeste chen. ahhas. i heard of her name before and met her but never really talked to her. saw her at parties and oh man, she is so popular luhs. ahhas. she ain't bad looking and she's hot ks. too bad i don't know her well. oh well. (:

ok, and now back to what happened earlier on. while shopping at jurong point, mandy suddenly saw the girl who's with mandy's ex and that fcuking bitch came over and said, 'hi' to mandy. i thought that maybe she and mandy were friends or something and then suddenly that bitch scolded mandy a 'fcuking whore'. omg. wth. mandy and that bitch had a quarrel right in the shopping centre and oh shit. i did something that i think i am not gonna regret. ahhas. i slapped her. i mean, i said, 'hey' and she looked at me and i just slapped her. ahhas. it's like a drama series luhs. x : wth. and i just pulled mandy by her hand and walked off. i effing swear that that bitch almost screamed. whatever luhs. am so happy. ((:

mike came over and now he's with sher in the living room. ahhas. psycho. i don't wanna see him. ):< argh. ok, but on account that he bought me something from his trip, i shall forgive him. ahhas. going out for dinner later. woohoo! byebyebye. <3s.

my evil side


'



finally after for like a long time of surfing the net and laming around, i am back to neopets. ahhas. childish acts of decisions and lame games but hey. it helps to kill time. (: 3hours more to meeting mandy for shopping madness and i am so bored like hell. anyone online? im me now to chat! ANYONE!

argh. wtfcuk. my denim skirt was stuck inbetween the opening of my room door and when i pulled it, it tore! wth. now what am i to do? buy a new one i guess. ahhas. yes. a new denim skirt! ((: woohoo! life is so fabulous when you are me. someone envies me. ahhas. here's what i got in my email.

'=) you are so pretty. i saw your photo in friendster. your life is so perfect after reading your blog. you have a great family and a good boyfriend. i wish i have your life. i envy you and can we be friends? here is my photo. =) please reply me and sorry if i offended you.'

ahhas. am i really that scary that even when a stranger sends me an email, he/she must say sorry in it? oh well. guess i am. (: bytheway, she looks pretty. and and, she reminds me of someone. WENLIN! ahhas. yes, she looks like lin except for her eyes. anyone wants to know her? send me an email and i shall intro her to you. i have her email. ((: anyway, i replied her and i was kind to her ks. she ain't bad. did i forget to mention that she's only 14? ahhas.

oh man. i have only slept for 5hours and now i am wide awake. seriously, i am gonna have some serious panda eyes soon. whatever. toodles.

my evil side


'



yesterday was so fun and high. adeline's 2 birthday cake's icings ended up on shawn's and darren's face. ahhas. thanks to sher, ting, nette and me. ((: we were invincible. didn't eat much as i was kind of full after drinking loads of fruit juice. ahhas. went home at about 11pm and dad was like driving round in circles for no apparent reason. whatever.

was so damn freaking sleepy but now, sheesh. i am so wide awake. im-ed with lexa and had a three-way conversation in msn with manda and lexa. crapped about some guy in school and about next year. ended our conversation at 2am and called daryl to chat. chatted till 4am. wth. ahhas. what did we talk about? it's a secret. (: it's 4.30am now and i am so not sleepy anymore. wtfcuk. i wanna sleep and yet i can't fall asleep. x :

sorry guys, for not logging in to my friendster second account. so if there's any messages or testimonials, please send it to my first account. ((: i will log in to my second account as soon as i can remember to log in. ahhas. whatever luhs. shadow the big fat lump is sleeping so soundly now that not even 10 alarm clock can wake him up. any programmes for today? yes yes. i am going out with mandy to jurong point for shopping. oh yeah.

ok, so i am gonna try to sleep now. bless me. ahhas. lame luhs. (: byebyebye. <3s.

my evil side


6.12.06 '



wasn't at home the whole day and so didn't post. ahhas. where did i go? went to shop for adeline's birthday present with manda. (: yeaps. today is adeline's birthday and so am going to uncle fred's house later on with family. i bought something cute for adeline and manda was like, 'i want that too! why don't you buy for me?' ahhas. manda, grow up. ((:

after shopping at vivo with manda, we went to find gene over at clarke quay and we crapped around and took some totally insane photos. then we proceeded to orchard for some shopping fun and to find maine as she's working there. this reminds me of something. manda wants to find a job! ahhas. yes, it's true. manda wants to and so anyone has a job to introduce to her? but before you find her, here are some of her 'conditions'.

firstly, the working hours mustn't exceed 5hours. most ideal is from 12pm to 5pm.
secondly, the pay must range between $50 to $60 per day. which means $10 to $12 per hour.
thirdly, the location must be at orchard or bugis or anywhere fun with aircon.
fourthly, the work mustn't be too demanding or tedious. maybe sales girl.
lastly, leave must be applicable for like 5 pay leaves per month available.

ok, and so this are all her 'conditions' and know what i said? 'manda, why don't you just stay at home and ask your parents for money everyday?' ahhas. if there really is such a good job available, i believe everyone will rush for it. (: am watching cow and chicken now and omfcuk. it is so fcuking retard. any programmes for the day before going to uncle fred's house? ahhas. of course. i am going to find daryl and stay at his house for the whole afternoon and then i will probably just make my way over to uncle fred's house alone. ((:

my evil side


5.12.06 '



i feel so effing full and tired right now. ahhas. daryl's bbq was a big success! (: and the icings were smeared all over daryl's face. ahhas. enjoy it boy. so he has loads of presents luhs and come to think of it now, i don't know how we managed to take it all back to his house. oh well, we have our ways. ((:

manda and nic were like they have not eaten for the past few days and they kept going back for fries and taking more ingredients to cook. ahhas. daryl told me something funny. one of his friend wanted to know mandy and so asked daryl to introduce and daryl said to me, 'eh, one of my guy wants to get to know mandy. intro them to each other.' and i just laughed. i went up to him and said 'sorry guy. mandy is already attached but if you really want to be friends with her then i can still intro her to you. *smiles*' and he was like so disappointed. aww. how sad can and so when i told mandy about it, she was so excited to meet him luhs. ahhas. then she went up to him and said hi.

manda asked me a funny question. 'if you can change one word, what will it be?' and i was like wth. ahhas. guess my answer. i said, 'the answer is. i will change the word, uranus.' and we were laughing like hell luhs. ahhas. yes, it was a perfect answer. (:

we left at about 10.30pm and daryl and i took the mrt back to his house first to put his presents and then he offered to send me home. we sat at the park near his house and then waited till 12am then took the mrt to amk. reached home around 1am or so then daryl left as we were both too exhausted. now it's 2am and oh boy, my eyes are so heavy. well then, toodles and night. <3.

my evil side


4.12.06 '



jing was like asking me to upload the photos that we took last night onto friendster and so i just finished uploading it. jing, go grab them from my friendster. (: so daryl called me and explained that he was kind of in a bad mood as one of his friend was hospitalize and he just learnt of it from that girl. ok, i don't know if it's true but i trust that he won't lie to me. loads of peeps are gonna attend daryl's bbq party tonight and so am going to get prepared for it earlier with daryl. eventhough all the ingredients are available at marina. ahhas. ((:

my eyes are frigging heavy as didn't sleep much with gene's turning and jing's leg crossing my leg. ahhas. it was a disaster of how we slept. should have taken a photo as a memory. ahhas. psycho luhs. sher handed me some cd covers and said 'here, smash them when you are bored.' x : wth. ahhas. whatever. now i have more cd covers to smash! ((:

i have bought the perfect gift for him and well, i am gonna give it to him when everyone else it gone. ahhas. it's a secret. (: the bbq starts at 5pm and manda and i are gonna take the cake there and so i guess i won't hang around daryl all day long. i am beginning to wonder if 2 cakes will be enough for all. ohman. well then guess what are the flavors? choco and vanilla! yeaps. daryl's favourite and mine too. ahhas.

nel brought me home this morning as something happened last night after the party. his gf broke up with him and he was kinda depressed and so wanted to talk to me but i fell asleep in the mrt and rested my head on his shoulder. ahhas. sorry bro and thanks for being there for my head. ahhas. x : then a girl said, 'see, her bf so good. let her rest her head on his shoulder and never disturb her. why you always disturb me?' omfcuk. when i heard that i immediately opened my eyes but i still continued on laying my head on nel's shoulder as it was just so comfy. nel stared at them and just smiled. ahhas. what a cute bro. (: and please people, we are not together. nel, don't be upset ok? you still have us, your wonderful friends and we will always be here for you. it's her loss that she left you and so she will soon regret it. ((:

to her: who do you think you are? when i saw you for the first time i thought that you looked quite decent and should be those goody type of girl. i was quite surprised as to why nel will fancy such a girl like you but hey. love is blind. it's ok if you are occasionally making nel to run errands for you and making him wait for you for like 2hours or so but you actually 2 timed him and flirted with other guys at the party. wtfcuk. if you seriously think that just because nel loves you then you can do all this things to him then you are so wrong. you are just being a plain slut and nel deserves so much better. you claim that he is just an ah beng but he isn't. he is different from a typical ah beng ks. he is a great guy and he is a great friend. you are the one who's being a whore here and so now that you have left nel's life, don't ever come back again.

i have never seen nel devoting so much feelings into a relationship and he was really depressed this morning. hope that the bbq later on will cheer him up. (:

my evil side


'



i don't ask for anything else or more. all i ask for is for you to treat me well like how you usually do but why can't you do that yesterday? i don't mind if you flirt with other girls or try to hook up with them in front of me but at least when i talk to you in the middle, you can try to answer me back and not just say 'sugar, go find manda and the others first. i will find you shortly.' and continue on talking to that girl. you know what? whatever. if you feel that i am childish and unreasonable then be it.

argh. i hate you! daryl lim jun hao!

nicolelai's party was great except for something inbetween. partied till 1am and went off with manda, lexa, nic, gene and jing to manda's house. crapped around and had a pillow fight then slept over at manda's house till 8am. gene was like turning left and right all night long. ahhas. when i woke up, saw daryl's sms which reads 'why didn't you tell me when you left?' and all i replied was 'well, you were so engrossed in that girl. why else will you care about me?' and the others were history.

i am not gonna cry over something stupid and yayness. nic got 3rd in the bikini fashion show. ((: ahhas. she was so hot! no programmes for the day. not even sure if i am going to celebrate daryl's birthday with him. oh well, whatever comes. byebyebye.

anyway, HAPPY BIRTHDAY TO YOU!

my evil side


3.12.06 '



argh. so effing bored now can. can't wait for 5pm to come and off to meet up with my 'gang'. ahhas. god'em plus gf plus sisters plus d&s plus bros, what does that makes it? a group of rojak gang. yay. ahhas. lame luhs. ((: i suddenly miss watching chip and dale. my darling chipmunks! whatever.

the kandi bar is open and boy, i can't wait to go check it out. am just gonna wait till daryl brings me there. ahhas. (: how angelic. x : i don't think i will be sleeping at home tonight. yes yes yes. it means that i am probably spending the night at either manda's house or whoever's house. ((: ahhas. just not your house.

wtfcuk. someone actually sent me this email. 'hey there. do you smoke? you do sound like a typical ah lian. =)' wth. omg. omfcuk. wtfcuk. I SMOKE?! argh. shit you, whoever that sent me that. I DON'T SMOKE! it's bad for my health and my teeth. ahhas. =D *shiny teeth* and i repeat once and for all, I AM NOT AN AH LIAN! ah lians are so lame can. whatever guy. show me your smiley face somemore. *puke*

ok. time now is 4.45pm. byebyebye and off i go. <3.

my evil side


'



wadayadaladamadaradanadafadagadahadapadakawabunga!

ahhas. don't ask me what was that. i just feel like it. (: my morning was pretty screwed up. i mean, im-ed with manda to crap about stuffs and chose my outfit for tonight, fought with sher over my eye shadow and mascara, ate loads of chocs and made choco fudge drink and i gained 1kg. wtfcuk. so that's how i survived my morning.

lolllolllolllolllolllolllolllolllolllolllolllol
lolllolllolllolllolllolllolllolllolllolllolllol
lolllolllolllolllolllolllolllolllolllolllolllol
lolllolllolllolllolllolllolllolllolllolllolllol
lolllolllolllolllolllolllolllolllolllolllolllol
lolllolllolllolllolllolllolllolllolllolllolllol

ahhas. this reminds me of a fencing thingy. whatever. just take it that i am insane. ((: no drive to blog. byebye. <3.

my evil side


'



my day yesterday was so totally fine. (: ahhas. went off to bugis with my god'em yesterday and bought a hot bikini in the color of blue. ahhas. so fine. and nic bought a hot pink bikini to go with her slippers. double fine. ((: crapped around loads with mandy and laughed like nobody's business. took some photos in the fitting room with jing and tried out loads of different designs of tee. we started shopping from morning 10am till 6pm, it was too bad that i had a dinner date with my family. ahhas. otherwise we would have shopped till late night.

had dinner at four seasons hotel at orchard and they ordered loads of food luhs. omg. but i must try to resist the temptation or else i will gain at least 2kgs. ahhas. darren is so handsome like wth. chatted with him and found out that he has a gf in newzealand. omfcuk. and he didn't even let his parents know about it. sher and shawn knew about it too and promised not to tell our parents. ahhas. do you think it will last with sher's big mouth? (:

had a family photo taken and we, meaning sher, shawn, darren plus me, took photos together and boy, i really miss those good ol'days. darren is going off in a few days time and yeaps, will probably go see him off. argh. shit, my tummy hurts now. it's 9am now and sher is still sleeping like a log. ahhs. whatever. gonna go lumberjack my shadow now. whatever that means. ((:

my evil side


2.12.06 '



let me start off this by saying, THE ICE CREAM TREAT WAS SUPERCALIFRAGILISTICESPIELIDOCIOUS! ahhas. i enjoyed every drop of it and i seriously wanna thanks daryl my deary darr for all that and thanks for making that the happiest day. (:

went to uncle fred's house and saw cute adeline crying because she's hungry. ahhas. so effing adorable. played with brownie and blackie and fed them some munchies. went off to daryl's house shortly as it was quite nearby and on my way saw a stray kitten alone, so small and so poor thing and so i went to this shed near the beach and bought some tuna for it. ahhas. so cute can. continued on to daryl's house and his sister was like so hyper luhs. she came running towards me with some money in her hand and asked me to bring her to buy some snacks. when we came back, daryl was standing by the door and smirking like wth. ahhas. psycho guy. ((:

he changed and we went to the airport's swensen and i ordered ice creams, ice creams and more ice creams. didn't order their meal as all i wanted was ice creams. ahhas. two girls were looking at our table and i bet they are thinking 'why did they order so many ice cream? can she even finish it?' and guess what? I FINISHED IT ALL! yes, i did and boy, am i happy. (: i did something psycho. i kissed daryl on his cheek when my lips were smeared with chocs ice cream. ahhas. smile boy. went off to the viewing mall after that fabulous and delicious treat and took some photos.

going out with my darling god'em today and boy, am i happy happy happy! ahhas. gonna buy my dream bikini and then it's off to dinner with my family and cousin darren! ((: nothing is gonna spoil my day.

my evil side


1.12.06 '



tralalalala! yayness baby! ahhas. i am totally insane. (: going to a hotel for dinner with family tomorrow night, after shopping with god'em. darren is coming back from overseas tomorrow morning and so that explains the dinner but he will be off again on the 8th of dec. took some self portrait of myself earlier on and one of them looks so horny can. ahhas. i must praise my photographic skills.

omg. omg. omg! i just heard a shocking news on msn and personally from lexa. she has a new bf! wth. it has already been 2days and now then she tells us. ahhas. anyway, congrats lexa and when are you gonna introduce us to him? make it fast ks? ahhas. give me the 101 girl, starting from how did you get to know him? im-ed with lexa and she was like so craze luhs.

`stac. be my guy forever. be your girl forever. says:
wtfcuk. get out!
lalala~alexa.lexa.lalexa! says:
chill will ya. sheesh.
`stac. be my guy forever. be your girl forever. says:
omg. how can i chill? THIS IS SHOCKING!
`stac. be my guy forever. be your girl forever. says:
what's his name?
lalala~alexa.lexa.lalexa! says:
not that shocking.his name is benson.he studies at sas.
`stac. be my guy forever. be your girl forever. says:
sas? st andrew's or singapore american? cool man. ahhas.
lalala~alexa.lexa.lalexa! says:
sgp amer.
`stac. be my guy forever. be your girl forever. says:
and so when can we meet him?
lalala~alexa.lexa.lalexa! says:
ah.no way.u guys will onli scare him away.haha
lalala~alexa.lexa.lalexa! says:
he is way too shy. omg.
`stac. be my guy forever. be your girl forever. says:
ahhas. we won't. (: we are just too warm.

ahhas. and so there you go, her new benson guy. and lexa, don't worry, we won't scare him away. we will just make sure that he likes us. ((:

my evil side


'



my life is so frigging bored today. haven't been out with my god'em for a long time. oh yes, tomorrow am going out with my lovely god'em. ((: i seriously think that i have no life after the o's. alone at home, bored to death, threw my cd covers around, jumped up and down, hugged and cuddled shadow, played with water, almost drowned mum's flowers, made a mess of my room, ransacked sher's room, ate loads of chocs, called manda to crap, sms-ed daryl to disturb him, spammed lexa's taggy, called nel to find entertainment, im-ed with jing to bitch, view people's friendster profile, sent crazy messages to friends and strangers, screamed 'iamsototallybored. argh. fcukyou!' through the theatre system mic, watched tv and changed the channel's for like a thousand and one times and scolded the crows for being so noisy. ahhas. yes, my day is so boring.

i am gonna buy a hot bikini tomorrow for nicolelai's party. (: nic asked me to take part in the bikini show but i rejected her as i don't think i want to model in front of so many people. i get stage fright you know. ahhas. yes, today is the one month anniversary with daryl and i am so happy. lalaing feeling is coming straight to me. ahhas. daryl is taking me to swensen later and you all know what that means. ICE CREAM! loads and truck loads of ice cream for me. don't worry about my figure, i will still maintain it at 45kg. (:

i found some old photos when i was flipping through my photo album and found one which brought back some crazy, funny yet precious memories. taken when i was at orchard's sakae with jason, nel, manda, lexa, lav, jing, mandy, nic, gene, maine and edwin. still remembered that we were crapping about this ah lian from another class and how she stared at nic whenever she walked past her. the funny part was that nic will always say 'ohmyfreakinggod! look who's here? it's that big shot ah jie. *bang bang!*' ahhas. sound effect are done by edwin. those memories were really precious. don't ask me what's up with nic and that big shot. ahhas. they just don't see eye to eye. (:

i seldom attend public party as well, i just don't like it. i prefer private party where the people are the ones that i know. unless of course it's sher's or one of her friend's party then of course, her 'friends' will all come and turn it into a crazy town. ahhas. i have been thinking of the past these past few days and suddenly i thought of this. the june holidays and to us, it was no holiday but going back to school for extra lessons and then lin thought of skipping one lesson, social studies, as she dreaded it. so i accompanied her to help her fulfil her crazy idea and we went to town to shop. ahhas. lin was wearing this extra short shorts luhs and her butt cheek was almost showing. omfcuk. she is a very daring girl and so guys, don't be fooled by her name, wenlin. ahhas. she is nothing like her name for her name makes her sound like a gentle and quiet girl. AHHAS! yeah right. there was this old man looking at her butt for quite a long time when we were in the mrt and when i told her that, she immediately said, 'eeek. cheekopek.' omg. i almost cried while laughing and wth. she even shook her butt and laughed loudly. i swear that she is the most daring girl i have ever met. ((:

my eyes are sore from staring at all those porn that manda sent. ahhas. ok, how lame luhs. manda sent me some dirty rated jokes and now i am just trying to kill time. well then, blog more later. byebyebyebyebyebyebye! <3.

my evil side


'



any programmes today? think i may be going to uncle fred's house alone later to see my cute lil adeline. (: and then going to daryl's house to see if he is at home. come to think of it, daryl's birthday and my cousin adeline's birthday is just a day inbetween. ahhas.

Please take note that NicoleLai's house party is only for those whom knows NicoleLai and/or anyone close to her. ((: Get your entry pass from her latest by 9pm tonight!

nothing much to blog about now and so blog more later. oh oh, and i did some editing to my 5.11.06 post of my beloved ones. (: i deleted her name.

my evil side


'



i am so effing pissed off now and darn it. my hp has been ringing all morning. someone anonymous kept calling me and when i answered it, he said 'hello' and hung up. wtfcuk. ok, i am not going to bother myself with that idiot. (: and now for some happy things.

went off to causeway point to meet daryl yesterday and when i saw him, i immediately laughed luhs. his hair was in such a mess that he looked like he met with an accident. ahhas. and i pulled him to the toilet to get him to style his hair and then went to eat at mos burger. shopped around the second level and well, there was nothing much to buy and so after shopping for about 30minutes or so, we took the mrt home. what an eventful day. ((:

alighted at amk and daryl sent me home and by then it was already close to 8.30pm and daryl had to go back to school early in the morning and so i asked him to go home and he kissed me goodbye. how many 'and' are there in that sentence? ahhas. sher borrowed my eye shadow last week and since then it has been missing! argh. sher, you better find it back or else. ahhas. (:

regarding that friendster friend request thing, some people actually really went to add me and so i viewed their profile and added them. ahhas. see, i told you i am KIND. ((: don't worry, as long as you don't provoke me, i won't scold you or say some bad things about you. x : well then, it's time to go feed that hungry shadow. toodles. <3.

my evil side


La Music

Heat up ♥

-; - feat -

De Code

This is me ♥

IAM STACYTAN
MYNICKS STAC&KITTY&YEE
CURRENTLY 18
DATE 28thSEPT
blissfully attached

Stay Forever

My loves ♥

MANDA MYPANDA
ZHIHAO DEE
NELSON MYDARLINGBRO
KELING MYTWIN
ANDREW MYBROE
JONYE MYHUNNYBRO
SHERLIN MYBITCH
SHAWN MYHUNK
MUMMY MUMMY
DADDY DADDY
SHADOW BABYDOG

Gang Loves

Hoes & Bros ♥

PANDA & KITTY
DEE&YEE
AJLS
NEL & STAC
GF's

Shut Up

My Prerogative ♥

&Don't judge me base on a few comments.
.You don't even know me.
&This is my blog.
.I type whatever I want here.
&You have no rights to discriminate me for my language.
.I bet you use them too.
&Kohzhihao is mine.
.Yes he is.
&My friends are my life.
.If you object to that, then poor you.
&Lastly, I am StacyTan.
.And this is MY BLOG.
Need I say more?

My Past


Credits

Arigatou ♥

Designer : blen-ded.notes♥
Layouts : Edited from the codings (:
Codings : Createblog & Dynamicdrive
Images : Paint , devianart & dafont
Others : Imeem & Scribbleland :D

Foot Note

Yummilicious ♥